- YIF1A Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89362
- Immunohistochemistry, Immunohistochemistry-Paraffin
- YIF1A
- This antibody was developed against Recombinant Protein corresponding to amino acids: ALMYFIVRSL RTAALGPDSM GGPVPRQRLQ
- 0.1 ml (also 25ul)
- FinGER7, YIF1P, YIF1, 54TM
- Human, Mouse, Rat
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Yip1 interacting factor homolog A, membrane trafficking protein
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
Specifications/Features
Available conjugates: Unconjugated